Invitrogen™ Human APBB3 (aa 310-394) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109542	100 μL

Catalog No. RP109542 Supplier Invitrogen™ Supplier No. RP109542

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

Specifications

• Accession Number: O95704
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10307
• Name: Human APBB3 (aa 310-394) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: amyloid beta (A4) precursor protein-binding, family B, member 3; amyloid beta A4 precursor protein-binding family B member 3; amyloid beta precursor protein binding family B member 3; amyloid precursor interacting protein; Amyloid-beta A4 precursor protein-binding family B member 3; APBB3; Fe65L2; fe65-like protein 2; Protein Fe65-like 2; Rirl2; SRA; TR2S
• Common Name: APBB3
• Gene Symbol: APBB3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining