Invitrogen™ Human APEX2 (aa 275-389) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104857	100 μL

Catalog No. RP104857 Supplier Invitrogen™ Supplier No. RP104857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes a protein shown to have a weak class II AP endonuclease activity. Most of the encoded protein is located in the nucleus but some is also present in mitochondria. This protein may play an important role in both nuclear and mitochondrial base excision repair (BER).

Specifications

• Accession Number: Q9UBZ4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27301
• Name: Human APEX2 (aa 275-389) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AP endonuclease 2; AP endonuclease XTH2; Ape2; APEX nuclease (apurinic/apyrimidinic endonuclease) 2; APEX nuclease 2; APEX nuclease-like 2; APEX2; APEXL2; apurinic/apyrimidinic endodeoxyribonuclease 2; apurinic/apyrimidinic endonuclease 2; apurinic/apyrimidinic endonuclease-like 2; Apurinic-apyrimidinic endonuclease 2; C430040P13Rik; DNA-(apurinic or apyrimidinic site) lyase 2; RP5-884M20.3; XTH2; ZGRF2; zinc finger, GRF-type containing 2
• Common Name: APEX2
• Gene Symbol: APEX2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLDYVLGDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPVLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining