Invitrogen™ Human Aquaporin 12 (aa 246-290) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104335	100 μL

Catalog No. RP104335 Supplier Invitrogen™ Supplier No. RP104335

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aquaporin 12 (AQP12) is the most recently identified member of the mammalian AQP family and is specifically expressed in pancreatic acinar cells. In vitro expression studies have revealed that AQP12 is localized at intracellular sites. To determine the physiological roles of AQP12 in the pancreas, we generated knockout mice for this gene (AQP12-KO). No obvious differences were observed under normal conditions between wild-type (WT) and AQP12-KO mice in terms of growth, blood chemistry, pancreatic fluid content, or histology. However, when we induced pancreatitis through the administration of a cholecystokinin-8 (CCK-8) analog, the AQP12-KO mice showed more severe pathological damage to this organ than WT mice.

Specifications

• Accession Number: A6NM10, Q8IXF9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 375318, 653437
• Name: Human Aquaporin 12 (aa 246-290) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AQP12; AQP-12; AQP12A; AQP12B; AQP-12B; AQPX2; aquaporin 12; aquaporin 12A; aquaporin 12B; aquaporin X2; aquaporin-12; aquaporin-12A; Aquaporin-12B; INSSA3; insulin synthesis associated 3; RGD1562727
• Common Name: Aquaporin 12
• Gene Symbol: AQP12A, AQP12B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining