Invitrogen™ Human ARAP2 (aa 1614-1702) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96597	100 μL

Catalog No. RP96597 Supplier Invitrogen™ Supplier No. RP96597

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57465. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARAP2 also known as Centaurin-delta-1 is a protein with ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology domains. A phosphatidylinositol-3, 4, 5-trisphosphate-dependent GTPase-activating protein, ARAP2, binds to RhoA-GTP, but lacks the predicted catalytic arginine in the RHO-GAP domain and does not have RHO-GAP activity. It modulates actin cytoskeleton remodeling by regulating ARF and RHO family members. Usually ARAP2 is activated by phosphatidylinositol-3, 4, 5-trisphosphate (PtdIns(3, 4, 5)P3) binding and can be activated by phosphatidylinositol-3, 4-bisphosphate (PtdIns(3, 4, 5)P2) binding, albeit with lower efficiency. ARAP2 associates with focal adhesions and functions downstream of RhoA to regulate focal adhesion dynamics. It is usually detected in brain, thymus, lymph node, thyroid, spinal cord, trachea, heart, skeletal muscle, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes.

Specifications

• Accession Number: Q8WZ64
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 116984
• Name: Human ARAP2 (aa 1614-1702) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Arap2; Arf and Rho GAP adapter protein 2; arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2; centaurin; centaurin, delta 1; centaurin-delta-1; CENTD1; Cnt-d1; Gm148; KIAA0580; mKIAA0580; PARX; PARX protein; Protein PARX
• Common Name: ARAP2
• Gene Symbol: ARAP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining