Invitrogen™ Human ARMH1 (aa 162-229) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109737	100 μL

Catalog No. RP109737 Supplier Invitrogen™ Supplier No. RP109737

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144852. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARMH1 (Armadillo repeat-containing protein 1) is a cytoplasmic protein that belongs to the armadillo repeat family of proteins. It is involved in the regulation of cell proliferation, differentiation, and apoptosis, and has been implicated in the development of various cancers.

Specifications

• Accession Number: Q6PIY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 339541
• Name: Human ARMH1 (aa 162-229) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Armadillo-like helical domain containing protein 1; ARMH1; C1orf228; chromosome 1 open reading frame 228; NCRNA00082; p40; uncharacterized protein C1orf228
• Common Name: ARMH1
• Gene Symbol: C1orf228
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPKAQQLSLQTLRTAQPIIGTTHPSIVDCVLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining