Invitrogen™ Human ARMX3 (aa 38-175) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104543	100 μL

Catalog No. RP104543 Supplier Invitrogen™ Supplier No. RP104543

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene.

Specifications

• Accession Number: Q9UH62
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51566
• Name: Human ARMX3 (aa 38-175) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200004E24Rik; AI450003; ALEX3; ARM protein lost in epithelial cancers on chromosome X 3; arm protein lost in epithelial cancers, X chromosome, 3; armadillo repeat containing X-linked 3; armadillo repeat containing, X-linked 3; armadillo repeat-containing X-linked protein 3; armadillo repeat-containing X-linked protein 3-like protein; Armcx3; BM-017; dJ545K15.2; DKFZp781N1954; GASP6; KIAA0443; MGC12199; Protein ALEX3; UNQ2517/PRO6007
• Common Name: ARMX3
• Gene Symbol: ARMCX3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining