Invitrogen™ Human Aromatase (aa 340-415) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101314	100 μL

Catalog No. RP101314 Supplier Invitrogen™ Supplier No. RP101314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111329. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis, three successive hydroxylations of the A ring of androgens. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. The gene expresses two transcript variants.

Specifications

• Accession Number: P11511
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1588
• Name: Human Aromatase (aa 340-415) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Ar; ArKO; ARO; ARO1; Arom; Aromatase; aromatase 1; aromatase cytochrome P450; aromatase cytochrome P450 19A1; CPV1; CYAR; Cyp19; Cyp19a; Cyp19a1; CYP19P1; CYPXIX; CYPXIXA1; Cytochrome P450 17-alpha; cytochrome P450 19 type I; Cytochrome P450 19A1; cytochrome P450 aromatase; cytochrome P-450 aromatase; cytochrome P-450 aromatase (alt.); cytochrome P450 family 19 subfamily a; cytochrome P450 family 19 subfamily A member 1; Cytochrome P450, 19, aromatase; cytochrome P450, family 17, subfamily A, polypeptide 1; cytochrome P450, family 19, subfamily A, polypeptide 1; cytochrome P450, family XIX (conversion of androgen to estrogen), aromatase; cytochrome P450, family19, subfamily A, polypeptide 1; cytochrome P450, subfamily 19; cytochrome P450, subfamily XIX (aromatization of androgens); cytochrome P-450AROM; estrogen synthase; estrogen synthetase; flavoprotein-linked monooxygenase; Int5; Int-5; MGC104309; microsomal monooxygenase; P450AROM; P-450AROM; type III cytochrome p450 aromatase
• Common Name: Aromatase
• Gene Symbol: Cyp19a1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining