Invitrogen™ Human Arp3 (aa 320-357) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99034	100 μL

Catalog No. RP99034 Supplier Invitrogen™ Supplier No. RP99034

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Specifications

• Accession Number: P61158
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10096
• Name: Human Arp3 (aa 320-357) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200003A09Rik; Actin-like protein 3; actin-related protein 3; actin-related protein 3 homolog (yest); ACTR3; Arp3; ARP3 actin related protein 3 homolog; ARP3 actin-related protein 3; ARP3 actin-related protein 3 homolog; ARP3 actin-related protein 3 homolog (yeast)
• Common Name: Arp3
• Gene Symbol: ACTR3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining