Invitrogen™ Human ARPP21 (aa 3-142) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90682	100 μL

Catalog No. RP90682 Supplier Invitrogen™ Supplier No. RP90682

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the 'pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: Q9UBL0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10777
• Name: Human ARPP21 (aa 3-142) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0710001E13Rik; AI853636; ARPP21; Arpp-21; cAMP regulated phosphoprotein 21; cAMP regulated phosphoprotein 21kDa; cAMP-regulated phosphoprotein (21 kDa); cAMP-regulated phosphoprotein 21; cyclic AMP-regulated phosphoprotein 21; cyclic AMP-regulated phosphoprotein, 21; cyclic AMP-regulated phosphoprotein, 21 kD; D9Bwg1012e; Ppp1r1c; Ppp1r1cl; protein phosphatase 1, regulatory (inhibitory subunit 1C); protein phosphatase 1, regulatory (inhibitory) subunit 1C; protein phosphatase 1, regulatory subunit 1C; R3H domain containing 3; R3HDM3; RCS; Regulator of calmodulin signaling; RGD1307208; RGD1307215; TARPP; thymocyte ARPP; thymocyte cAMP-regulated phosphoprotein
• Common Name: ARPP21
• Gene Symbol: ARPP21
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining