Invitrogen™ Human ASCT2 (aa 1-52) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95784	100 μL

Catalog No. RP95784 Supplier Invitrogen™ Supplier No. RP95784

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83264. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC1A5 (Solute carrier family 1 (neutral amino acid transporter), member 5) is a member of the Na(+)-dependent amino acid transporter superfamily. It has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Specifications

• Accession Number: Q15758
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6510
• Name: Human ASCT2 (aa 1-52) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AAAT; ASC-like Na(+)-dependent neutral amino acid transporter ASCT2; Asct2; ATB(0); ATB0; ATBO; baboon M7 virus receptor; CAZ-associated structural protein; H4-ASCT2; H4-system ASC-like transporter; insulin-activated amino acid transporter; M7V1; M7VS1; neutral amino acid transporter B; neutral amino acid transporter B(0); R16; RD114 virus receptor; RD114/simian type D retrovirus receptor; RDR; RDRC; SLC1A5; Slc1a7; sodium-dependent neutral amino acid transporter ASCT2; sodium-dependent neutral amino acid transporter type 2; solute carrier family 1 (neutral amino acid transporter), member 5; solute carrier family 1 member 5; solute carrier family 1, member 7
• Common Name: ASCT2
• Gene Symbol: SLC1A5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining