Invitrogen™ Human ASMTL (aa 159-299) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92339	100 μL

Catalog No. RP92339 Supplier Invitrogen™ Supplier No. RP92339

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51979. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene has an N-terminus that is similar to the multicopy associated filamentation (maf) protein of Bacillus subtilis and to orfE of Escherichia coli, while the C-terminus is similar to N-acetylserotonin O-methyltransferase. This gene is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O95671
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8623
• Name: Human ASMTL (aa 159-299) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: acetylserotonin N-methyltransferase-like; acetylserotonin O-methyltransferase-like; ASMTL; ASMTLX; ASMTLY; ASTML; dTTP/UTP pyrophosphatase; dTTPase/UTPase; N-acetylserotonin O-methyltransferase-like protein; Nucleoside triphosphate pyrophosphatase; Nucleotide PPase; Nucleotide pyrophosphatase; Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein
• Common Name: ASMTL
• Gene Symbol: ASMTL
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKLYYPPRPEDLRRSVKHDSIPAADTFEDLSDVEGGGSEPTQRDAGSRDEKAEAGEAGQATAEAECHRTRETLPPFPTRLLELIEGFMLSK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining