Invitrogen™ Human ATF2 (aa 237-379) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100704	100 μL

Catalog No. RP100704 Supplier Invitrogen™ Supplier No. RP100704

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82792. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transcription factor ATF-2 (also called CRE-BP1) binds to both AP-1 and CRE DNA response elements and is a member of the ATF/CREB family of leucine zipper proteins. ATF-2 interacts with a variety of viral oncoproteins and cellular tumor suppressors and is a target of the SAPK/JNK and p38 MAP kinase signaling pathways. Various forms of cellular stress, including genotoxic agents, inflammatory cytokines and UV irradiation, stimulate the transcriptional activity of ATF-2. Cellular stress activates ATF-2 by phosphorylation of Thr69 and Thr71. Both SAPK and p38 MAPK have been shown to phosphorylate ATF-2 at these sites in vitro and in cells transfected with ATF-2.

Specifications

• Accession Number: P15336
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1386
• Name: Human ATF2 (aa 237-379) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Activating 2; Activating transcription factor 2; activating transcription factor 2 splice variant ATF2-var2; ATF2; Atf-2; cAMP response element-binding protein CRE-BP1; cAMP responsive element binding protein 2, formerly; cAMP-dependent transcription factor ATF-2; CREB2; CREB-2; CRE-BP; CREBP1; CRE-BP1; Cyclic AMP-dependent transcription factor ATF-2; cyclic AMP-responsive element-binding protein 2; D130078H02Rik; D18875; HB16; Histone acetyltransferase ATF2; MGC111558; mXBP; MXBP protein; OTTHUMP00000205345; OTTHUMP00000205347; OTTHUMP00000205348; OTTHUMP00000205350; OTTHUMP00000205352; OTTHUMP00000205353; OTTHUMP00000205354; Tg(Gzma-Klra1)7Wum; TREB7
• Common Name: ATF2
• Gene Symbol: Atf2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining