Invitrogen™ Human ATG12 (aa 97-139) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109913	100 μL

Catalog No. RP109913 Supplier Invitrogen™ Supplier No. RP109913

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144967. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATG12, a member of the autophagy protein family, forms a conjugate with ATG5; this conjugate has a ubiquitin-protein ligase (E3)-like activity for protein lipidation in autophagy. This conjugate also associates with innate immune response proteins such as RIG-I and VISA (also known as IPS-1), inhibiting type I interferon production and permitting viral replication in host cells. ATG12 has also been shown to interact with ATG10 in human embryonic kidney cells in the presence of ATG7. At least two isoforms of ATG12 are known to exist. Autophagy, the process of bulk degradation of cellular proteins through an autophagosomic-lysosomal pathway is important for normal growth control and may be defective in tumor cells. It is involved in the preservation of cellular nutrients under starvation conditions as well as the normal turnover of cytosolic components. This process is negatively regulated by TOR (Target of rapamycin) through phosphorylation of autophagy protein APG1.

Specifications

• Accession Number: O94817
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9140
• Name: Human ATG12 (aa 97-139) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4931423H11Rik; A330058M13Rik; APG 12; APG12; Apg12 (autophagy, yeast) homolog; APG12L; APG12-like; ATG12; ATG12 autophagy related 12 homolog; Atg12l; Atg12p; Atg12-PB; Autophagy protein 12-like; autophagy related 12; autophagy related protein 12; autophagy-related 12; autophagy-related protein 12; Autophagy-specific gene 12; CG10861; CG10861-PB; Dmel\CG10861; Dmel_CG10861; FBR93; HAPG12; IP05205p; IP05405p; OTTHUMP00000159129; ubiquitin-like protein ATG12; YBR1506; YBR217W
• Common Name: ATG12
• Gene Symbol: ATG12
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining