Invitrogen™ Human ATG4B (aa 322-393) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105486	100 μL

Catalog No. RP105486 Supplier Invitrogen™ Supplier No. RP105486

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cysteine protease ATG4b is an enzyme which is coded by ATG4b gene. Autophagy is a critical cellular homeostatic process that controls the turnover of damaged organelles and protein. ATG4bis a deubiquitin-like protease that plays dual roles in the core machinery of autophagy. ATG4b, cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3, GABARAPL1, GABARAPL2 and GABARAP, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. ATG4b is mainly expressed in the skeletal muscle, brain, heart, liver and pancreas.

Specifications

• Accession Number: Q9Y4P1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23192
• Name: Human ATG4B (aa 322-393) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2510009N07Rik; APG4 (ATG4) autophagy-related homolog B; APG4 autophagy 4 homolog B; APG4B; ATG4 autophagy related 4 homolog B; Atg4b; atg4b protein; Atg4bl; AUT2B; Aut2B1; Aut2b2; AUTL1; AUT-like 1 cysteine; AUT-like 1 cysteine endopeptidase; AUT-like 1, cysteine endopeptidase; autophagin 1; autophagin-1; Autophagin-2B; autophagy related 4 homolog B; autophagy related 4B cysteine peptidase; autophagy related 4B, cysteine peptidase; autophagy-related 4B; autophagy-related cysteine endopeptidase 1; Autophagy-related cysteine endopeptidase 2B; autophagy-related protein 4 homolog B; AW048066; bAut2B; Cysteine protease ATG4B; cysteine protease involved in autophagy APG4-B; hAPG4B; KIAA0943
• Common Name: ATG4B
• Gene Symbol: Atg4b
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining