Invitrogen™ Human ATM (aa 2946-3021) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107548	100 μL

Catalog No. RP107548 Supplier Invitrogen™ Supplier No. RP107548

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84748. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ataxia-telangiectasia Mutated (ATM) is a protein that belongs to the PI3/PI4 kinase family. Ataxia-telangiectasia is a rare autosomal recessive disorder characterized by progressive neurologic degeneration, immunologic deficiency, and an increased risk of lymphoid cancer. The ATM gene codes for a protein belonging to the phosphoinositide 3-kinase (PI3K) superfamily. ATM phosphorylates proteins instead of lipid and has many downstream targets that act as cell-cycle regulators including: P53, Mdm2, BRCA1, and SMC1. The ATM protein is responsible for repairing double-stranded DNA breaks that occur because of ionizing radiation and other mutagens. The ATM's C-terminal region has extensive homology to the catalytic domains of phosphatidylinositol 3-kinases (PI3 kinases). Studies have shown that ATM becomes autophosphorylated and upregulated by exposure to ionizing radiation. AT cells are hypersensitive to ionizing radiation, impaired in mediating the inhibition of DNA synthesis and display delays in p53 induction. Further, DNA damage caused by ionizing irradiation activates ATM-kinase, leading to a cascade of kinase reactions that regulate cell cycle, apoptosis, and DNA damage repair. Studies have linked ATM to apoptosis along with Nbs1 and Chk2 in the E2F1 pathway.

Specifications

• Accession Number: Q13315
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 472
• Name: Human ATM (aa 2946-3021) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI256621; AT mutated; A-T mutated; A-T mutated homolog; AT mutated protein; AT1; ATA; Ataxia t; Ataxia telangiectasia gene mutated in human beings; ataxia telangiectasia mutated; Ataxia telangiectasia mutated homolog; ATC; ATD; ATDC; ATE; Atm; ATM serine/threonine kinase; C030026E19Rik; DKFZp781A0353; EC 2.7.1.37; MGC74674; serine-protein kinase ATM; TEL1; TEL1, telomere maintenance 1, homolog; TELO1
• Common Name: ATM
• Gene Symbol: ATM
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining