Invitrogen™ Human ATP11A (aa 697-791) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94972	100 μL

Catalog No. RP94972 Supplier Invitrogen™ Supplier No. RP94972

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57324. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP11A is a widely expressed integral membrane ATPase. ATP11A is probably phosphorylated in its intermediate state and likely drives the transport of ions such as calcium or other molecules across membranes. While the exact molecule ATP11A transports is unknown, increased expression of ATP11A mRNA has been observed in murine leukemia cells made resistant to anti-cancer drugs such as farnesyltransferase inhibitors (FTIs). Furthermore, overexpression of ATP11A provided protection against the FTI SCH66336 while knockdown of ATP11A via siRNA made cells more sensitive to this drug. Other reports suggest that elevated levels of ATP11A mRNA may also be a predictive marker of metastasis in colorectal cancer patients.

Specifications

• Accession Number: P98196
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23250
• Name: Human ATP11A (aa 697-791) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930558F19Rik; ATP11A; ATPase 11A, class VI; ATPase 11A, p type; ATPase class VI type 11A; ATPase IS; ATPase phospholipid transporting 11A; ATPase, class 1, member h; ATPase, class VI, type 11A; Atpc1h; ATPIH; ATPIS; AU040868; Ih; KIAA1021; P4-ATPase flippase complex alpha subunit ATP11A; phospholipid-translocating ATPase; potential phospholipid-transporting ATPase IH; probable phospholipid-transporting ATPase IH; RP11-120K24.1; Ua20
• Common Name: ATP11A
• Gene Symbol: ATP11A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining