Invitrogen™ Human ATP4B (aa 70-159) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99966	100 μL

Catalog No. RP99966 Supplier Invitrogen™ Supplier No. RP99966

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83771. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha- subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.

Specifications

• Accession Number: P51164
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 496
• Name: Human ATP4B (aa 70-159) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: (H+,K+)-ATPase beta-subunit; ATP4B; ATP6B; ATPase H+/K+ transporting beta subunit; ATPase H+/K+ transporting subunit beta; ATPase H+K+-transporting beta / (gastric HK-ATPase beta subunit) defined by SSR; ATPase, H+,K+-transporting, beta / (gastric H,K-ATPase beta subunit), defined by SSR; ATPase, H+/K+ exchanging, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide; ATPase, H+/K+ transporting, beta polypeptide, gastric specific; AV080843; gastric H(+)/K(+) ATPase subunit beta; gastric H+/K+ ATPase beta subunit; gastric H+/K+-ATPase beta subunit; gastric hydrogen-potassium ATPase, beta; gp60-90; H,K-ATPase-Beta; H.K-ATPase, beta subunit; H+,K+-ATPase; H+/K+ ATPase beta; H+/K+ ATPase beta subunit; H+/K+-ATPase beta; H+/K+-ATPase beta subunit; potassium-transporting ATPase beta chain; potassium-transporting ATPase subunit beta; Proton pump beta chain; S76401S1
• Common Name: ATP4B
• Gene Symbol: ATP4B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining