Invitrogen™ Human AXUD1 (aa 128-197) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106858	100 μL

Catalog No. RP106858 Supplier Invitrogen™ Supplier No. RP106858

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Axin, an important regulator of beta-catenin, is frequently mutated in human hepatocellular carcinomas (HCCs), and transduction of the wild-type Axin gene (AXIN1) induces apoptosis in HCC cells as well as in colon cancer cells. A novel gene, AXUD1 (AXIN1 up-regulated), has enhanced expression in response to exogenously expressed AXIN1. It is expressed in all human tissues examined, most abundantly in lung, placenta, skeletal muscle, pancreas and leukocytes. Data suggests that AXUD1 may have a tumor-suppressor function in those organs.

Specifications

• Accession Number: Q96S65
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64651
• Name: Human AXUD1 (aa 128-197) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4931429D10Rik; AXIN1 up-regulated 1; Axin-1 up-regulated gene 1 protein; AXUD1; Csrnp1; CSRNP-1; cysteine and serine rich nuclear protein 1; cysteine/serine-rich nuclear protein 1; cysteine-serine-rich nuclear protein 1; DKFZp566F164; FAM130B; Protein URAX1; Taip3; TAIP-3; TGF-beta induced apoptosis protein 3; TGF-beta-induced apoptosis protein 3; URAX1; URAX1 protein
• Common Name: AXUD1
• Gene Symbol: CSRNP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining