Invitrogen™ Human B4GALT4 (aa 269-344) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107249	100 μL

Catalog No. RP107249 Supplier Invitrogen™ Supplier No. RP107249

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: O60513
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8702
• Name: Human B4GALT4 (aa 269-344) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9130402O08Rik; B4GALT4; b4Gal-T4; B4galt-IV; Beta-1,4-galactosyltransferase 4; beta-1,4-galactosyltransferase IV; beta-1,4-GalTase 4; beta4Gal-T4; beta4GalT-IV; beta-N-acetylglucosaminyl; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4; Lactotriaosylceramide beta-1,4-galactosyltransferase; N-acetyllactosamine synthase; Nal synthase; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; UNQ552/PRO1109
• Common Name: B4GALT4
• Gene Symbol: B4GALT4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining