Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90039

Invitrogen™ Human B7-H3 (aa 30-130) Control Fragment Recombinant Protein

Catalog No. RP90039
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90039 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90039 Supplier Invitrogen™ Supplier No. RP90039
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82573. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD276 is a member of the B7 family of co-stimulatory molecules also known as B7-H3. CD276 is a type I transmembrane protein that induces the proliferation of CD4+ and CD8+ T cells, enhances the generation of cytotoxic T cells and selectively stimulates the production of interferon gamma. Expression of CD276 can be induced on dendritic cells and monocytes by inflammatory cytokines, and is also widely expressed in peripheral tissues including the heart, kidney, testis and colon. In humans, CD276 exists as two isoforms which result from gene duplication and differential splicing. CD276 is reported to have therapeutic potential for the regulation of cell-mediated immune responses to cancer, particularly in conjunction with anti-angiogenic therapy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5ZPR3
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 80381
Name Human B7-H3 (aa 30-130) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4Ig-B7-H3; 6030411F23Rik; AU016588; B7 homolog 3; B7h3; B7-H3; B7RP-2; CD276; CD276 antigen; CD276 molecule; CD276 molecule tv1; costimulatory molecule; PSEC0249; sB7 H3; sB7H3; sCD276; soluble B7 H3; soluble B7H3; soluble CD276; UNQ309/PRO352
Common Name B7-H3 (CD276)
Gene Symbol CD276
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.