Invitrogen™ Human BAAT (aa 1-74) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92967	100 μL

Catalog No. RP92967 Supplier Invitrogen™ Supplier No. RP92967

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54386. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: Q14032
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 570
• Name: Human BAAT (aa 1-74) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI118337; AI158864; Baat; BACAT; BAT; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid CoA:amino acid N-acyltransferase; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase); Bile acid-CoA thioesterase; Bile acid-CoA:amino acid N-acyltransferase; bile acid-Coenzyme A dehydrogenase: amino acid n-acyltransferase; bile acid-Coenzyme A: amino acid N-acyltransferase; Choloyl-CoA hydrolase; Glycine N-choloyltransferase; kan-1; Long-chain fatty-acyl-CoA hydrolase; taurine N-acyltransferase
• Common Name: BAAT
• Gene Symbol: BAAT
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining