Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human Band 3 (aa 6-103) Control Fragment Recombinant Protein

Catalog No. RP103809
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103809 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103809 Supplier Invitrogen™ Supplier No. RP103809
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64140. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Band 3 protein is the most abundant integral protein of human erythrocyte membranes and functions as the major anion transporter polypeptide of erythrocytes. Band 3 is a 90-100 kDa protein, its microheterogeneity is ascribed mainly to the structural heterogeneity of the carbohydrate moiety. The C-terminal portion of the molecule spans the membrane several times, and is responsible for anion transport. The N-terminal portion, comprising almost half of the polypeptide chain of Band 3, is located inside the red cell and interacts with cytoskeletal and cytoplasmic proteins such as ankyrin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P02730
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6521
Name Human Band 3 (aa 6-103) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AE 1; AE1; anion exchange protein 1; anion exchanger 1; anion exchanger-1; band 3 anion transport protein; BND3; CAMP; CD233; CHC; DI; Diego blood group; EMPB3; EPB3; erythrocyte membrane protein band 3; erythroid anion exchange protein; FR; Froese blood group; l11Jus51; MEB3; MGC116750; MGC116753; MGC126619; MGC126623; RTA1A; SAO; Slc4a1; solute carrier family 4 (anion exchanger), member 1; solute carrier family 4 (anion exchanger), member 1 (Diego blood group); solute carrier family 4 member 1; solute carrier family 4 member 1 (Diego blood group); solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group); solute carrier family 4, anion exchanger, number 1; Solute carrier family 4, member 1, anion exchange protein 1 (kidney band 3); SPH4; SW; Swann blood group; Waldner blood group; WD; WD1; WR; Wright blood group; ZNF828
Common Name Band 3
Gene Symbol SLC4A1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.