Invitrogen™ Human BAT5 (aa 397-442) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101614	100 μL

Catalog No. RP101614 Supplier Invitrogen™ Supplier No. RP101614

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity.

Specifications

• Accession Number: O95870
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7920
• Name: Human BAT5 (aa 397-442) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Abhd16a; abhydrolase domain containing 16A; abhydrolase domain-containing protein 16A; AI326074; Alpha/beta hydrolase domain-containing protein 16A; Bat5; Bat-5; D17H6S82E; D6S82E; G5; hBAT5; HLA-B associated transcript 5; HLA-B-associated transcript 5; HLA-B-associated transcript 5 homolog; mBAT5; Monoacylglycerol lipase ABHD16A; Ng26; Phosphatidylserine lipase ABHD16A; PP199; protein ABHD16A; protein BAT5; protein G5
• Common Name: BAT5
• Gene Symbol: ABHD16A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining