Invitrogen™ Human BAZ1B (aa 595-689) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110028	100 μL

Catalog No. RP110028 Supplier Invitrogen™ Supplier No. RP110028

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144868. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BAZ1B is a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Specifications

• Accession Number: Q9UIG0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9031
• Name: Human BAZ1B (aa 595-689) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BAZ1B; bromodomain adjacent to zinc finger domain 1B; bromodomain adjacent to zinc finger domain protein 1B; bromodomain adjacent to zinc finger domain, 1B; bromodomain adjacent to zinc finger domain, 1B; Williams-Beuren syndrome chromosome region 9 homolog; C87820; hWALp2; transcription factor WSTF; tyrosine-protein kinase BAZ1B; tyrosine-protein kinase BAZ1B; LOW QUALITY PROTEIN: tyrosine-protein kinase BAZ1B; Tyrosine-protein kinase BAZ1B-like protein; WBSC10; WBSCR10; WBSCR9; williams syndrome transcription factor; Williams syndrome transcription factor homolog; williams-Beuren syndrome chromosomal region 10 protein; Williams-Beuren syndrome chromosomal region 9 protein; williams-Beuren syndrome chromosomal region 9 protein homolog; Williams-Beuren syndrome chromosome region 9 homolog; Wstf
• Common Name: BAZ1B
• Gene Symbol: BAZ1B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining