Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human BCL11A (aa 525-607) Control Fragment Recombinant Protein

Catalog No. RP109516
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109516 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109516 Supplier Invitrogen™ Supplier No. RP109516
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H165
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 53335
Name Human BCL11A (aa 525-607) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2810047E18Rik; B cell CLL/lymphoma 11A; B cell CLL/lymphoma 11A (zinc finger protein); BAF chromatin remodeling complex subunit BCL11A; B-cell CLL/lymphoma 11A; B-cell CLL/lymphoma 11A (zinc finger protein); B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2; B-cell lymphoma/leukemia 11A; BCL11A; BCL-11A; BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1; BCL11A, BAF complex component; BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; C2H2-type zinc finger protein; COUP-TF interacting protein 1; COUP-TF-interacting protein 1; CTIP1; D930021L15Rik; ecotropic viral integration site 9 homolog; ecotropic viral integration site 9 protein; Ecotropic viral integration site 9 protein homolog; Evi9; EVI-9; Evi9a; Evi9b; Evi9c; FLJ10173; FLJ34997; HBFQTL5; Kiaa1809; mKIAA1809; myeloid leukemia; zinc finger protein 856; ZNF856
Common Name BCL11A
Gene Symbol BCL11A
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.