Invitrogen™ Human BCL9L (aa 738-838) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106463	100 μL

Catalog No. RP106463 Supplier Invitrogen™ Supplier No. RP106463

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84153. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bcl9L, a homolog of Bcl9, was initially identified through a bioinformatics screening. It is expressed in fetal brain, adult lung, eye and prostate, in addition to several types of tumors including pancreatic and prostate cancers. Bcl9L has been shown to interact with beta-catenin, a target of the Wnt signaling pathway, and is required for enhanced beta-catenin-T-cell factor (TCF)-mediated transcription in colorectal tumor cells, possibly by translocating beta-catenin to the nucleus. Other studies have indicated that Bcl9L expression correlates with high nuclear grade cancer phenotype and the expression of ErbB2/HER-2 in breast cancers, suggesting that activity may occur in other types of cancer. Bcl9L has also been shown to be critical for Wnt-mediate regulation of stem cell traits in colon epithelium and adenocarcinomas which are associated with tumor invasion, metastasis, and resistance to therapy.

Specifications

• Accession Number: Q86UU0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 283149
• Name: Human BCL9L (aa 738-838) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B cell CLL/lymphoma 9-like; B9L; BC003321; B-cell CLL/lymphoma 9-like; B-cell CLL/lymphoma 9-like protein; B-cell lymphoma 9-like protein; BCL9-2; BCL9L; BCL9-like protein; BCL9-related beta-catenin-binding protein; DLNB11; nuclear co-factor of beta-catenin signalling; protein BCL9-2
• Common Name: BCL9L
• Gene Symbol: BCL9L
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGMEFGGGRGLLSPPMGQSGLREVDPPMGPGNLNMNMNVNMNMNMNLNVQMTPQQQMLMSQKMRGPGDLMGPQGLSPEEMARVRAQNSSGVMGGPQKMLMP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining