Invitrogen™ Human BMPR2 (aa 730-854) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106213	100 μL

Catalog No. RP106213 Supplier Invitrogen™ Supplier No. RP106213

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BMPR2 is a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs that are involved in endochondral bone formation and embryogenesis. The loss of interaction and lack of phosphorylation of TCTEL1 by BMPR2 may contribute to the pathogenesis of primary pulmonary hypertension (PPH) and BMPR2 also plays an essential role in human T-cell differentiation. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of two different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kDa and type II receptors of about 70-80 kDa. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in BMPR2 have been associated with primary pulmonary hypertension, both familial and fenfluramine-associated, and with pulmonary venoocclusive disease.

Specifications

• Accession Number: Q13873
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 659
• Name: Human BMPR2 (aa 730-854) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610024H22Rik; AL117858; AW546137; BB189135; BMP type II receptor; BMP type-2 receptor; BMP-2; BMPR2; BMPR-2; BMPR3; BMPRII; Bmpr-II; BMR2; bone morphogenetic protein receptor type 2; bone morphogenetic protein receptor type II; Bone morphogenetic protein receptor type-2; bone morphogenetic protein receptor, type II (serine/threonine kinase); bone morphogenic protein receptor, type II (serine/threonine kinase); BRK-3; Gm20272; POVD1; PPH1; T-ALK; type II activin receptor-like kinase; type II receptor for bone morphogenetic protein-4
• Common Name: BMPR2
• Gene Symbol: Bmpr2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining