Invitrogen™ Human BRIP1 (aa 993-1136) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102519	100 μL

Catalog No. RP102519 Supplier Invitrogen™ Supplier No. RP102519

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110693. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BRIP1 (BRCA1 Interacting Protein C-terminal Helicase 1) is a gene situated on chromosome 17q22, covering 19 exons within its 184-kb coding region to encode a protein containing 1249 amino acids. BRIP1 is integral to the DNA repair processes, specifically through its interaction with the BRCA1 gene, and is involved in the Fanconi anemia complementation group J (FANC J). Mutations in BRIP1 have been identified, playing a role in cancer predisposition with a notable eightfold increased risk for ovarian cancer and associations with cervical cancer risk through its single nucleotide polymorphisms (SNPs). Amplifications and other mutations of BRIP1 are prevalent in a variety of cancers, and its expression involves significant correlations with copy number variations (CNV) and DNA methylation across numerous tumor types. BRIP1's expression is upregulated in certain contexts, which can contribute to cancer progression, as evidenced in the Omani population with breast cancer. These interactions validate its association with DNA damage repair, cell cycle, and metabolism across multiple cancer types.

Specifications

• Accession Number: Q9BX63
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 83990
• Name: Human BRIP1 (aa 993-1136) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3110009N10Rik; 8030460J03Rik; ATP-dependent RNA helicase BRIP1; BACH 1; Bach1; BACH1 BRIP1; BRCA1 interacting protein C-terminal helicase 1; BRCA1/BRCA2-associated helicase 1; BRCA1-associated C-terminal helicase 1; BRCA1-binding helicase-like protein BACH1; BRCA1-interacting protein 1; BRCA1-interacting protein C-terminal helicase 1; BRIP 1; Brip1; FACJ; FANCJ; FANCJ protein; Fanconi anemia group J protein; Fanconi anemia group J protein homolog; FLJ90232; MGC126521; MGC126523; OF; Protein FACJ
• Common Name: BRIP1
• Gene Symbol: BRIP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining