Invitrogen™ Human BRWD1 (aa 2058-2145) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102579	100 μL

Catalog No. RP102579 Supplier Invitrogen™ Supplier No. RP102579

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56595. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDR9.3 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region 2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3' ends.

Specifications

• Accession Number: Q9NSI6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54014
• Name: Human BRWD1 (aa 2058-2145) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5330419I02Rik; bromodomain and WD repeat domain containing 1; bromodomain and WD repeat-containing protein 1; BRWD1; C21orf107; D530019K20Rik; DCAF19; FLJ43918; G1-403-16; N143; repro5; transcriptional unit N143; WD repeat domain 9; WD repeat protein WDR9-form2; WD repeat-containing protein 9; WDR9
• Common Name: BRWD1
• Gene Symbol: Brwd1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SHIPGSETDRTFSSESTLAQKATAENNFEVELNYGLRRWNGRRLRTYGKAPFSKTKVIHDSQETAEKEVKRKRSHPELENVKISETTG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining