Invitrogen™ Human c-Kit (aa 50-190) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102434	100 μL

Catalog No. RP102434 Supplier Invitrogen™ Supplier No. RP102434

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIT (c-KIT) is a proto-oncogene and a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). KIT was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. KIT together with its ligand regulates growth and activation of a variety of hemopoietic and non-hemopoietic cells. Mutations in KIT are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism. Recently, deregulation of the KIT receptor TK by the prevalent activation loop mutation D816V has served as a focal point in therapeutic strategies aimed at curbing neoplastic mast cell growth. c-Kit is expressed in hematopoietic stem cells, germ cells, mast cells and gastrointestinal tract cajal cells. Upon binding of its ligand stem cell factor (SCF), c-kit dimerizes, resulting in receptor activation and autophosphorylation of various tyrosine residues including tyrosine 703 located on the cytoplasmic domain of the receptor. This modification allows docking of Grb2 and activation of the Ras/ERK signaling pathway. SCF/c-kit can activate multiple downstream signaling pathways including PI3K, PLC-gamma and JAK/STAT. c-kit receptor activation is essential for hematopoiesis, stem cell maintenance and gametogenesis.

Specifications

• Accession Number: P10721
• Concentration: 3.90 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3815
• Name: Human c-Kit (aa 50-190) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: belly-spot; Bs; CD117; ckit; C-Kit; c-KIT gene1; c-kit protein; c-kit proto-oncogene protein; c-kit receptor; c-kit receptor tyrosine kinase; dominant spotting; Dominant white spotting; Fdc; Gsfsco1; Gsfsco5; Gsfsow3; KIT; kit oncogene; KIT proto-oncogene receptor tyrosine kinase; KIT proto-oncogene, receptor tyrosine kinase; mast cell growth factor receptor; mast/stem cell growth factor receptor; mast/stem cell growth factor receptor Kit; MGF; p145 c-kit; PBT; Piebald trait protein; protein kinase; proto-oncogene c-Kit; proto-oncogene tyrosine-protein kinase Kit; receptor tyrosine kinase c-kit; receptor tyrosine kinase type III; SCFR; SCO1; SCO5; Sl; soluble KIT variant 1; SOW3; spotted sterile male; Ssm; Steel Factor Receptor; Tr-kit; tyrosine kinase receptor; tyrosine kinase receptor c-KIT; tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; W
• Common Name: c-Kit (CD117)
• Gene Symbol: KIT
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining