Invitrogen™ Human C14orf100 (aa 115-147) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95254	100 μL

Catalog No. RP95254 Supplier Invitrogen™ Supplier No. RP95254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56661. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be a regulator of the duration of MAPK8 activity in response to various stress stimuli. Facilitates degradation of misfolded endoplasmic reticulum (ER) luminal proteins through the recruitment of components of the proteasome and endoplasmic reticulum-associated degradation (ERAD) system.

Specifications

• Accession Number: Q9P055
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51528
• Name: Human C14orf100 (aa 115-147) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C14orf100; CDA06; HSPC213; HSPC327; JAMP; JKAMP; JNK1/MAPK8-associated membrane protein; JNK1-associated membrane protein; JNK-associated membrane protein; Jun N-terminal kinase 1-associated membrane protein; medulloblastoma antigen MU-MB-50.4
• Common Name: C14orf100
• Gene Symbol: JKAMP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining