Invitrogen™ Human C19orf10 (aa 102-173) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98885	100 μL

Catalog No. RP98885 Supplier Invitrogen™ Supplier No. RP98885

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61304. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The interleukins are a broad family of well characterized cytokines, primarily of hematopoietic cell origin. Cytokines are small, soluble proteins with pleiotropic effects on a variety of cell types. Cytokines have a regulatory function over the immune system and mediate aspects of inflammatory response. IL-25 (also called SF20/IL-25) is a secreted bone marrow stroma-derived growth factor cytokine that is derived from Th2 T-cells. IL-25 belongs to the IL-17 cytokine family and is capable of amplifying allergic type inflammatory responses by its actions on other cell types. IL-25 binds to mouse thymic shared antigen-1 and supports lymphoid cell proliferation. Infusion of mice with IL-25 induces IL-4, IL-5, and IL-13 gene expression. IL-25 induced mice also develop epithelial cell hyperplasia, increased mucus secretion, and airway hyperreactivity, suggesting that IL-25 may be an important mediator of allergic disease via production of IL-4, IL-5, IL-13 and eotaxin.

Specifications

• Accession Number: Q969H8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56005
• Name: Human C19orf10 (aa 102-173) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C19orf10; CS010; D17Wsu104e; EUROIMAGE1875335; IL 25; IL 27; Il25; IL27; IL27w; interleukin 25; interleukin 27 working designation; Interleukin25; interleukin-25; LOC501282; Ly6elg; Mydgf; myeloid derived growth factor; myeloid-derived growth factor; R33729 1; R33729_1; R337291; SF20; similar to lymphocyte antigen 6 complex, locus E ligand; stromal cell-derived growth factor SF20; UPF0556 protein C19orf10; UPF0556 protein C19orf10 homolog
• Common Name: C19orf10
• Gene Symbol: MYDGF
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining