Invitrogen™ Human C19orf52 (aa 164-243) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99123	100 μL

Catalog No. RP99123 Supplier Invitrogen™ Supplier No. RP99123

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIMM29, also known as C19orf52, is identified as a novel subunit of the human TIM22 complex, which plays a critical role in the mitochondrial inner membrane. This protein is crucial for the stability of the TIM22 complex, which is responsible for the translocation of hydrophobic inner mitochondrial membrane proteins carrying internal targeting signals. TIMM29/C19orf52 is integrated into the mitochondrial inner membrane, exposing its C-terminus to the intermembrane space, and is vital for mitochondrial function and protein import pathways. This gene's importance is underscored by its involvement in processes related to mitochondrial integrity and its potential role in neurodegenerative disorders and viral interactions, such as those with the hepatitis B virus (HBV).

Specifications

• Accession Number: Q9BSF4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 90580
• Name: Human C19orf52 (aa 164-243) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810026J23Rik; C19orf52; chromosome 19 open reading frame 52; Mitochondrial import inner membrane translocase subunit Tim29; RGD1309188; RIKEN cDNA 1810026J23 gene; similar to hypothetical protein BC011833; TIM29; TIMM29; uncharacterized protein C19orf52; uncharacterized protein C19orf52 homolog
• Common Name: C19orf52
• Gene Symbol: TIMM29
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining