Invitrogen™ Human C1orf151 (aa 39-77) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99822	100 μL

Catalog No. RP99822 Supplier Invitrogen™ Supplier No. RP99822

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63797. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of C1orf151 remains unknown.

Specifications

• Accession Number: Q5TGZ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 440574
• Name: Human C1orf151 (aa 39-77) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310028O11Rik; C1orf151; MIC10; MICOS complex subunit MIC10; MICOS10; MINOS1; MIO10; mitochondrial contact site and cristae organizing system subunit 10; mitochondrial inner membrane organizing system 1; mitochondrial inner membrane organizing system protein 1; novel DUF543 domain containing protein; RGD1560187; RP5-1056L3.2; UPF0327 protein C1orf151; UPF0327 protein C1orf151 homolog
• Common Name: C1orf151
• Gene Symbol: MINOS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining