Invitrogen™ Human C1QBP (aa 107-188) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93199	100 μL

Catalog No. RP93199 Supplier Invitrogen™ Supplier No. RP93199

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Replication Protein A (RPA) (also known as human single-stranded DNA binding protein, or HSSB) is involved in DNA replication, repair, and recombination. RPA from human cells is a stable heterotrimer of 70kDa, 32-34kDa, and 11-14kDa subunits (RPA70, RPA32, and RPA14 respectively). RPA is required for the SV40 large tumor antigen-catalyzed unwinding of SV40 DNA and stimulates DNA polymerase alpha and delta. RPA34 is phosphorylated at the G1/S boundary of the cell cycle or upon exposure of cells to DNA damage-inducing agents including ionizing and UV radiation.

Specifications

• Accession Number: Q07021
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 708
• Name: Human C1QBP (aa 107-188) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA407365; AA986492; ASF/SF2-associated protein p32; C1q globular domain-binding protein; C1QBP; complement C1q binding protein; complement component 1 Q subcomponent-binding protein, mitochondrial; complement component 1, q subcomponent binding protein; D11Wsu182e; GC1QBP; gC1qR; gC1Q-R; gC1q-R protein; glycoprotein gC1qBP; HABP1; Hyaluronan-binding protein 1; mitochondrial matrix protein p32; p32; p33; RPA; SF2AP32; SF2p32; splicing factor SF2-associated protein
• Common Name: C1QBP
• Gene Symbol: C1QBP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining