Invitrogen™ Human C1r (aa 39-165) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95414	100 μL

Catalog No. RP95414 Supplier Invitrogen™ Supplier No. RP95414

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110634. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C1 component of human complement is a complex of three glycoproteins: C1q, C1r and C1s. C1r has a molecular weight of 83,000 and is present in plasma in an average concentration of 50 μg/mL, either as a complex with C1q and C1s or in the absence of C1q as a tetramer with C1s. The subcomponents of the C1 complex are responsible for the initiation of the classical pathway of complement activation.

Specifications

• Accession Number: P00736
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 715
• Name: Human C1r (aa 39-165) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI132558; C1r; C1ra; complement C1r; complement C1r subcomponent; Complement C1r subcomponent heavy chain; Complement C1r subcomponent light chain; Complement C1r-A subcomponent; Complement C1r-A subcomponent heavy chain; Complement C1r-A subcomponent light chain; Complement component 1 subcomponent r; Complement component 1 subcomponent r-A; complement component 1, r subcomponent; complement component 1, r subcomponent A; complement component 1, r-A subcomponent; mC1rA
• Common Name: C1r
• Gene Symbol: C1R
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining