Invitrogen™ Human C8orf48 (aa 86-156) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93866	100 μL

Catalog No. RP93866 Supplier Invitrogen™ Supplier No. RP93866

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55222. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The C8orf48 gene has been identified as a critical biomarker in colorectal cancer (CRC). Research indicates that C8orf48 plays a significant role in inhibiting tumorigenesis by regulating key signaling pathways. This gene is negatively associated with KRAS, BRAF, and MAP2K2 in normal colorectal tissues and negatively correlated with MAP2K2 in CRC tissues. These associations suggest that C8orf48 may function as a tumor suppressor by modulating pathways involved in cell proliferation, migration, and invasion. The gene's expression and methylation profiles have been extensively studied using data from The Cancer Genome Atlas (TCGA), and functional assays have confirmed its inhibitory effects on CRC cell growth. Additionally, C8orf48 has been identified as a direct target of miR-556, further elucidating its regulatory mechanisms. The findings underscore the potential of C8orf48 as a novel target for CRC prediction and therapy.

Specifications

• Accession Number: Q96LL4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 157773
• Name: Human C8orf48 (aa 86-156) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C8orf48; chromosome 8 open reading frame 48; uncharacterized protein C8orf48
• Common Name: C8orf48
• Gene Symbol: C8orf48
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KWINYLKLKDSNFERHQPDTKLPTEITRVSDEELNALQSYCTMKINLIHRRGDSKKKTSSRHKKLHLGLDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining