Invitrogen™ Human CABC1 (aa 5-88) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107086	100 μL

Catalog No. RP107086 Supplier Invitrogen™ Supplier No. RP107086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84511. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADCK3 serine/threonine kinase is a mitochondrial protein similar to yeast ABC1 that is a member of the ADCK family. CABC1 encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found.

Specifications

• Accession Number: Q8NI60
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56997
• Name: Human CABC1 (aa 5-88) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4632432J16Rik; aarF domain containing kinase 3; aarF domain-containing protein kinase 3; Adck3; AI462003; ARCA2; atypical kinase ADCK3, mitochondrial; Atypical kinase COQ8A, mitochondrial; Cabc1; Chaperone activity of bc1 complex-like; chaperone activity of bc1 complex-like, mitochondrial; chaperone, ABC1 activity of bc1 complex homolog; chaperone, ABC1 activity of bc1 complex like; Chaperone-ABC1-like; Coenzyme Q protein 8A; coenzyme Q8 homolog; coenzyme Q8A; COQ10D4; COQ8; COQ8A; mKIAA0451; PP265; SCAR9
• Common Name: CABC1
• Gene Symbol: COQ8A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining