Invitrogen™ Human CABIN1 (aa 1720-1800) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95344	100 μL

Catalog No. RP95344 Supplier Invitrogen™ Supplier No. RP95344

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60313. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcineurin binding protein (Cabin-1) and the corresponding rat homolog, designated Cain, are widely expressed nuclear phosphoproteins that regulate the serine/threonine phosphotase activity of calcineurin and influence T cell signaling and apoptosis. Calcineurin is required for the transcriptional activation of cytokines and the activation of various transcription factors, including NFAT, NFκB and AP-1, involved in T cell receptor (TCR)-mediated signaling. The regulation of calcineurin depends on the changes in intracellular calcium concentrations and the activity of protein kinase C. TCR activation results in PKC inducing the hyperphosphorylation of Cabin-1, which facilitates the high affinity binding of Cabin-1 to calcineurin. This complex formation, in turn, inhibits calcineurin activity and attenuates TCR-mediated signaling. Cabin-1 also associates directly with MEF-2 proteins, a family of transcription factors that regulate apoptosis signaling in T cells. This association between Cabin-1 and MEF-2 leads to the inhibition of MEF-2-mediated gene transcription and the inhibition of apoptosis.

Specifications

• Accession Number: Q9Y6J0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23523
• Name: Human CABIN1 (aa 1720-1800) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A330070M20Rik; CABIN1; CAIN; calcineurin binding protein 1; calcineurin binding protein cabin 1; calcineurin inhibitor; Calcineurin-binding protein cabin-1; KB-318B8.7; KIAA0330; Ppp3in; protein phosphatase 3 inhibitor
• Common Name: CABIN1
• Gene Symbol: CABIN1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining