Invitrogen™ Human CACNG3 (aa 203-239) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109621	100 μL

Catalog No. RP109621 Supplier Invitrogen™ Supplier No. RP109621

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium Channel gamma-3 is a member of voltage dependent calcium channels (VDCCs) which allows neurons to tailor calcium signaling to functionally discrete cellular regions. Although N-Type VDCCs exist before birth which is consistent with a role in migration, most N-Type VDCCs subunit expression is postnatal, and important in the genesis of synaptic transmission in discrete hippocampal fields. Calcium Channel gamma-3 is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. Further, Calcium Channel gamma-3 is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. Calcium Channel gamma-3 gene dysfunction is a susceptibility locus for childhood absence epilepsy.

Specifications

• Accession Number: O60359
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10368
• Name: Human CACNG3 (aa 203-239) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cacng3; CACNLB3; calcium channel, voltage-dependent, gamma subunit 3; calcium voltage-gated channel auxiliary subunit gamma 3; CaVgamma3; neuronal voltage-gated calcium channel gamma-3 subunit; TARP gamma-3; transmembrane AMPAR regulatory protein gamma-3; Voltage-dependent calcium channel gamma-3 subunit; voltage-gated calcium channel gamma subunit
• Common Name: CACNG3
• Gene Symbol: Cacng3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining