Invitrogen™ Human CAF1 p60 (aa 441-552) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91774	100 μL

Catalog No. RP91774 Supplier Invitrogen™ Supplier No. RP91774

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82772. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Chromatin assembly factor 1 (CAF-1) is a member of the histone chaperone family. It is required for inheritance of epigenetically determined chromosomal states, and in vitro, it promotes the assembly of chromatin during DNA replication and DNA repair. CAF-1 is a complex of three subunits; p150, p60, and p48. This complex is localized to the nucleus of human cells. Both the composition and the biochemical activity of CAF-1 are conserved among human, yeast, and Drosophila.

Specifications

• Accession Number: Q13112
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8208
• Name: Human CAF1 p60 (aa 441-552) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2600017H24Rik; C76145; CAF1; CAF-1; CAF1 p60; CAF-1 subunit B; CAF1A; CAF1P60; CAF-I 60 kDa subunit; CAF-I p60; CAF-Ip60; CHAF1B; Chromatin assembly factor 1 subunit B; chromatin assembly factor 1, subunit B; chromatin assembly factor 1, subunit B (p60); chromatin assembly factor I p60 subunit; fe36g06; gef; human chromatin assembly factor-I p60 subunit; LOW QUALITY PROTEIN: chromatin assembly factor 1 subunit B; M-phase phosphoprotein 7; MPHOSPH7; MPP7; p60 CAF1; p60-CAF1; wu:fd07c09; wu:fe36g06; wu:fv38g09; zgc:56096
• Common Name: CAF1 p60
• Gene Symbol: Chaf1b
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining