Invitrogen™ Human CALHM1 (aa 235-327) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91132	100 μL

Catalog No. RP91132 Supplier Invitrogen™ Supplier No. RP91132

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53779. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alzheimers disease (AD) is a progressive neurodegenerative disorder characterized by a massive loss of neurons in several brain regions and by the presence of senile plaques comprised of aggregated amyloid-beta (Abeta) peptides produced by the endoproteolysis of the amyloid precursor protein (APP). The calcium homeostasis modulator 1 (CALHM1) is a recently identified multipass transmembrane glycoprotein that controls cytosolic Ca2+ concentration and Abeta levels. While some studies suggest CALHM1 is significantly associated with risk of AD, other reports suggest there is no link. CALHM1 has been suggested to modulate the Ca2+-dependent proteolytic process of APP through controlling the level of cytosolic Ca2+.

Specifications

• Accession Number: Q8IU99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 255022
• Name: Human CALHM1 (aa 235-327) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: calcium homeostasis modulator 1; calcium homeostasis modulator protein 1; Calhm1; EG546729; Fam26c; family with sequence similarity 26, member C; Protein FAM26C; RGD1564891
• Common Name: CALHM1
• Gene Symbol: Calhm1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining