Invitrogen™ Human Calmyrin (aa 4-93) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108356	100 μL

Catalog No. RP108356 Supplier Invitrogen™ Supplier No. RP108356

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the calcium-binding protein family. The specific function of this protein has not yet been determined; however this protein is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining. This protein also interacts with integrin alphabeta, which may implicate this protein as a regulatory molecule for alphabeta.

Specifications

• Accession Number: Q99828
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10519
• Name: Human Calmyrin (aa 4-93) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: calcium and integrin binding 1; calcium and integrin binding 1 (calmyrin); calcium and integrin binding protein 1; calcium and integrin binding, protein kinase interacting protein; Calcium- and integrin-binding protein; calcium and integrin-binding protein 1; calmyrin; CIB; CIB1; Cibkip; CIBP; DNA-dependent protein kinase interacting protein; DNA-PK interaction protein; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; KIP1; LOW QUALITY PROTEIN: calcium and integrin-binding protein 1; PRKDCIP; protein kinase, DNA activated, catalytic polypeptide interacting protein; Sip2-28; SNK-interacting protein 2-28; testicular secretory protein Li 9
• Common Name: Calmyrin
• Gene Symbol: Cib1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining