Invitrogen™ Human Calpain S1 (aa 85-196) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89222	100 μL

Catalog No. RP89222 Supplier Invitrogen™ Supplier No. RP89222

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. Calpain S1 is a small subunit common to both calpain I and II and is associated with myotonic dystrophy.

Specifications

• Accession Number: P04632
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 826
• Name: Human Calpain S1 (aa 85-196) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 30K; Calcium-activated neutral proteinase small subunit; calcium-dependent protease; Calcium-dependent protease small subunit; Calcium-dependent protease small subunit 1; calcium-dependent protease, small subunit; calpain 4; calpain 4, small subunit (30K); calpain II regulatory subunit; calpain II regulatory subunit (EC 3.4.22.17); calpain regulatory subunit; Calpain small subunit 1; calpain, small polypeptide; calpain, small subunit 1; CALPAIN4; CANP; CANP small subunit; CANPS; Capa4; Capa-4; Capn4; CAPNS; CAPNS1; CDPS; CSS1; D7Ertd146e; small pol; unknown protein
• Common Name: Calpain S1
• Gene Symbol: CAPNS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining