Invitrogen™ Human Calretinin (aa 132-264) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88707	100 μL

Catalog No. RP88707 Supplier Invitrogen™ Supplier No. RP88707

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calretinin is encoded by the CALB2 gene located on chromosome 16. It is a troponin C superfamily protein having six EF-hand structural motifs. The EF motif allows the protein to bind calcium, and function in calcium signaling, calcium buffering, and modulating neuronal excitability. Calretinin is expressed in the mesothelium, mast cells, some neural cells, hair follicles, and fat cells.

Specifications

• Accession Number: P22676
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 794
• Name: Human Calretinin (aa 132-264) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 29 kDa calbindin; 29 kD calretinin; 29 kDa calbindin; CAB29; CAL2; Calb2; calbindin 2; calbindin 2, (29 kD, calretinin); calbindin 2, 29 kDa; calbindin D29K; calretinin; CR; testicular secretory protein Li 8
• Common Name: Calretinin
• Gene Symbol: CALB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining