Invitrogen™ Human CaMKK alpha (aa 451-505) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95195	100 μL

Catalog No. RP95195 Supplier Invitrogen™ Supplier No. RP95195

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CAMKK1 (CAMKKA) is a serine/threonine protein kinase family member, and belongs to the Ca2+/calmodulin-dependent protein kinase subfamily. The product of CaMKK alpha is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. CAMKK1 functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Five transcript variants encoding distinct isoforms have been identified for CaMKK alpha. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

Specifications

• Accession Number: Q8N5S9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84254
• Name: Human CaMKK alpha (aa 451-505) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI846603; alpha CaMKK; calcium calmodulin dependent protein kinase kinase alpha; calcium/calmodulin dependent protein kinase kinase 1; calcium/calmodulin-dependent protein kinase kinase 1; calcium/calmodulin-dependent protein kinase kinase 1, alpha; calcium/calmodulin-dependent protein kinase kinase alpha; CaM-kinase IV kinase; caM-kinase kinase 1; caM-kinase kinase alpha; Camkk; caMKK 1; caM-KK 1; caMKK alpha; CaM-KK alpha; CAMKK alpha protein; CAMKK1; CAMKKA; CaMKKalpha
• Common Name: CaMKK alpha
• Gene Symbol: CAMKK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining