Invitrogen™ Human Carbonic Anhydrase IX (aa 335-410) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103210	100 μL

Catalog No. RP103210 Supplier Invitrogen™ Supplier No. RP103210

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111410. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic anhydrase (CA) is an enzyme that assists rapid interconversion of carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. It is abundant in all mammalian tissues. There are many genes that are inducible by hypoxia, via HIF-1 alpha. CA IX is one of the most inducible genes because of its stability and location within the membrane. Carbonic anhydrases have a widespread role in regulating pH in normal tissues, by regulating hydrogen ion (H+) flux. The pH is important in cell death under hypoxia, thus a blockade of CA IX results in increased cell death under hypoxia. Therefore, CA IX has become a reliable histochemical marker of hypoxia.

Specifications

• Accession Number: Q16790
• Concentration: 4.90 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 768
• Name: Human Carbonic Anhydrase IX (aa 335-410) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Ca9; CA-9; CAIX; CA-IX; Car9; Carbonate dehydratase IX; carbonic anhydrase 9; Carbonic anhydrase IX; carbonic dehydratase; G250; Membrane antigen MN; membrane antigen MN homolog; MN; MN/CA9; P54 / 58N; P54/58N; pMW1; RCC-associated antigen G250; RCC-associated protein G250; renal cell carcinoma-associated antigen G250
• Common Name: Carbonic Anhydrase IX
• Gene Symbol: CA9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PCAQGVIWTVFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining