Invitrogen™ Human CASK (aa 283-421) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92154	100 μL

Catalog No. RP92154 Supplier Invitrogen™ Supplier No. RP92154

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CASK is a calcium/calmodulin-dependent serine protein kinase which is a MAGUK (membrane-associated guanylate kinase) protein family member. CASK is a scaffold protein and the encoded protein is located at synapses in the brain. CASK associates with FG syndrome 4, mental retardation, microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. CASK functions as a cytoskeletal membrane scaffold that coordinates signal transduction pathways within the cortical cytoskeleton.

Specifications

• Accession Number: O14936
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8573
• Name: Human CASK (aa 283-421) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CAGH39; calcium/calmodulin dependent serine protein kinase; calcium/calmodulin-dependent serin protein kinase; Calcium/calmodulin-dependent serine protein kinase; calcium/calmodulin-dependent serine protein kinase (MAGUK family); calcium/calmodulin-dependent serine protein kinase membrane-associated guanylate kinase; CAMGUK; CASK; CMG; DXPri1; DXRib1; FGS4; G-protein-coupled receptor GPR34; hCASK; LIN2; LIN-2; MGC7449; MICPCH; mLin-2; MRXSNA; OTTHUMP00000023157; OTTHUMP00000023161; OTTHUMP00000023162; Pals3; peripheral plasma membrane protein CASK; Protein lin-2 homolog; RP23-278L4.1; TNRC8; trinucleotide repeat containing 8
• Common Name: CASK
• Gene Symbol: Cask
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining