Invitrogen™ Human Catenin alpha-1 (aa 262-303) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105263	100 μL

Catalog No. RP105263 Supplier Invitrogen™ Supplier No. RP105263

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Can associate with both E- and N-cadherins. Originally believed to be a stable component of E-cadherin/catenin adhesion complexes and to mediate the linkage of cadherins to the actin cytoskeleton at adherens junctions. In contrast, cortical actin was found to be much more dynamic than E-cadherin/catenin complexes and CTNNA1 was shown not to bind to F-actin when assembled in the complex suggesting a different linkage between actin and adherence junctions components. The homodimeric form may regulate actin filament assembly and inhibit actin branching by competing with the Arp2/3 complex for binding to actin filaments. May play a crucial role in cell differentiation.

Specifications

• Accession Number: P35221
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1495
• Name: Human Catenin alpha-1 (aa 262-303) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: [a]E-catenin; 102 kDa cadherin-associated protein; 2010010M04Rik; AA517462; AI988031; alpha E catenin; alpha E-catenin; alpha(E)-catenin; alpha-E-catenin; cadherin associated protein; Cadherin-associated protein; CAP102; catenin (cadherin associated protein), alpha 1; catenin (cadherin-associated protein), alpha; catenin (cadherin-associated protein), alpha 1; catenin (cadherin-associated protein), alpha 1, 102kDa; catenin alpha 1; catenin alpha 1 S homeolog; catenin alpha-1; catenin, alpha 1; Catna1; cell-adhesion protein alphaE catenin; ctnna; ctnna1; ctnna1.S; MDPT2; Renal carcinoma antigen NY-REN-13; XELAEV_18020018mg
• Common Name: Catenin alpha-1
• Gene Symbol: CTNNA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEERFRP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining