Invitrogen™ Human CAZIP (aa 527-620) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94984	100 μL

Catalog No. RP94984 Supplier Invitrogen™ Supplier No. RP94984

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56758. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CAZIP, also known as TIP150, contains a leucine-zipper domain at the C-terminus and has at least three isoforms. CAZIP is expressed in heart during early cardiac development and in parts of the nervous system in later embryonic development. It is thought to bind microtubules and facilitate the end-binding protein 1 (EB1)-dependent loading of MCAK onto microtubules plus ends and orchestrates the dynamics at the plus end of microtubules. CAZIP may regulate the dynamics of microtubules at their growing distal tip.

Specifications

• Accession Number: Q5JR59
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23281
• Name: Human CAZIP (aa 527-620) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: +TIP of 150 kDa; 5730592G18Rik; A730013O20Rik; AU067634; C130038G02Rik; Cardiac zipper protein; CAZIP; Gm763; ICIS; Kiaa0774; microtubule associated tumor suppressor candidate 2; microtubule plus-end tracking protein TIP150; Microtubule-associated tumor suppressor candidate 2; microtubule-associated tumor suppressor candidate 2 homolog; mKIAA0774; Mtus2; RGD1562533; RP11-274A8.2; Tip150; tracking protein of 150 kDa
• Common Name: CAZIP
• Gene Symbol: MTUS2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSVLNIPAPLHPETTVNMTYQPTTPSSSFQDVSVFGMDAGSPLVVPPPTDSARLLNTSPKVPDKNTCPSGIPKPVFTHSKDTPSSQEGMENYQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining